PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01880.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 238aa    MW: 27502.8 Da    PI: 8.209
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01880.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.2e-171057148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT++Ed llv+ v+ +G ++W+ +a+  g++Rt+k+c++rw +yl
  Rsa1.0_01880.1_g00001.1 10 KGPWTEQEDILLVNFVHTFGDRRWDFVAKVSGLNRTGKSCRLRWVNYL 57
                             79********************************************97 PP

2Myb_DNA-binding53.17.1e-1763108148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T++E+   +++++++G++ W++Ia++++ gRt++++k++w++++
  Rsa1.0_01880.1_g00001.1  63 RGKMTPQEERHVLELHAKWGNR-WSKIAKKLP-GRTDNEIKNYWRTHM 108
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.107157IPR017930Myb domain
SuperFamilySSF466899.35E-308104IPR009057Homeodomain-like
SMARTSM007172.0E-15959IPR001005SANT/Myb domain
PfamPF002492.4E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-211164IPR009057Homeodomain-like
CDDcd001675.19E-111257No hitNo description
PROSITE profilePS5129426.57958112IPR017930Myb domain
SMARTSM007171.3E-1562110IPR001005SANT/Myb domain
PfamPF002498.6E-1663107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-2465111IPR009057Homeodomain-like
CDDcd001673.83E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MKNVQEEYRK GPWTEQEDIL LVNFVHTFGD RRWDFVAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGKMTPQE ERHVLELHAK WGNRWSKIAK KLPGRTDNEI KNYWRTHMRK QAQEKKRPMS  120
PTSSSSNCCS SSMTTATTQD TGGSNGKMNQ ECDDGNYSMD DIWREIDQSG ANIIKPVKDI  180
YYSEQSCYLN FPPLSPTWES SLESIWNMGA DESKMSSFAI DQFPLSFEHD TSAWSSLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2771121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBMTransfer from AT5G59780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC9667400.0KC966740.1 Brassica napus MYB transcription factor 59 (MYB59.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010443755.11e-158PREDICTED: transcription factor MYB59-like isoform X1
SwissprotQ4JL841e-152MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A078IHY71e-155A0A078IHY7_BRANA; BnaA10g12770D protein
TrEMBLM4CEA21e-155M4CEA2_BRARP; Uncharacterized protein
STRINGBra002533.1-P1e-155(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-146myb domain protein 59